PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004489714.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 397aa    MW: 45058 Da    PI: 8.057
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004489714.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.66e-333892155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprl+Wt++LHerF+eav+qLGG++kAtPkt+l+lm+++gLtl+h+kSHLQkYR+
  XP_004489714.1 38 KPRLKWTTDLHERFIEAVNQLGGADKATPKTVLKLMGIPGLTLYHLKSHLQKYRI 92
                    79****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.2873595IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-303693IPR009057Homeodomain-like
SuperFamilySSF466891.97E-163793IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-233893IPR006447Myb domain, plants
PfamPF002498.7E-104091IPR001005SANT/Myb domain
PfamPF143792.0E-25139185IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MYYNHHQQAR NMHALRMQIQ GGGNGSGDSG LVLSTDAKPR LKWTTDLHER FIEAVNQLGG  60
ADKATPKTVL KLMGIPGLTL YHLKSHLQKY RISKTMNGQT NTGSSKIALT TEVSSRMSEA  120
SGIHMKHLSI GLQTNKNSEI NEAFNMQMEV QRRLHEQLEV QKHLQLRIEA QGKYLQSVLE  180
KAKETLGTQN LGTMGLDDAK VQLSKFTSRV SNENLDSKFL GLKELHVHWP QQTREDETID  240
YSMGSFLTNS EDSQRDQEMH NKGMKLGVSK ECVDEPMPLK NDFTLCEKEK ENVMFVSSSN  300
HRVLKDGLTT SLLLMNVGGV HEKENMWKRT ISKEDLKGEE WKRINNIETN GVQLKLNSDK  360
ISQDYRLANF EVKLDLNSND ASSQCQKFDL NGFSWNC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1395850.0BT139585.1 Medicago truncatula clone JCVI-FLMt-20F6 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004489714.10.0PREDICTED: uncharacterized protein LOC101512896 isoform X1
TrEMBLA0A072U7680.0A0A072U768_MEDTR; Myb-like transcription factor family protein
STRINGGLYMA16G26820.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38523163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-105G2-like family protein